Garder ma session ouverte ?
Fin de session dans  
La session a expirée
Votre session a expiré. Pour votre sécurité, nous vous avons déconnecté.
Voulez-vous vous connecter à nouveau?

Anti-SORD Mouse Polyclonal Antibody

Marques : US Biological
Recommended dilution: Immunochemistry: 3μg/ml

Type: Primary
Antigen: SORD (sorbitol dehydrogenase)
Clonality: polyclonal
Clone:
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG
Reactivity: Human



 

COMMANDE

Développer tout / Réduire tout
Taille Cdt Référence VWR Quantité
50 µg 50 µG USBI133706
Generate Barcodes Barcode Label Format: 
Créer les pages catalogue sous PDF

SPÉCIFICATIONS

Symbole antigène SORD
Nom de l'antigène sorbitol dehydrogenase
Réactivité Human
Conjugaison Unconjugated
Clonalité Polyclonal
Type d' Anticorps Primary
Hôte Mouse
Isotype IgG
Western blot Yes
Amino acid number 1 to 357
Purification purified by Protein A chromatography
Sequence MAAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGTLVLVGLGSEMTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNP
Form liquid
Storage buffer PBS, pH 7,2.
Température de stockage Cool
Shipping temperature Ice

ÉCRIRE UN AVIS

Besoin d'aide ?

  • Précisez ce que vous avez aimé et ce que vous n'avez pas apprécié.
  • Le produit répond-il à vos attentes ?
  • A qui le recommanderiez-vous ?

C'est sous ce nom que VWR va publier votre avis.
Nous recommandons aux auteurs d'utiliser leurs initiales.

Merci de confirmer votre secteur d'activité

Exemple : Recherche Pharmaceutique

Merci de confirmer votre fonction

Exemple : Chercheur

Merci de confirmer votre ville

Exemple : Lille, Clermont

AVIS (0)

Total Evaluation: 0
Moyenne des Notes : 0.0 sur 5

Classer par:

Entrer les détails pour la recherche

Sélectionner les article pour lesquels vous recherchez le certificat

Indiquer le N° de lot. Ce champs est obligatoire. Entrer un "X" si inconnu pour les PC.

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Ou
Editer et comparer les propositions
Nous avons trouvé des articles alternatifs qui vous permettraient d économiser jusque par emballage :   Pour comparer selectionnez jusqu à 3 propositions ci-dessous et cliquer sur comparer. Pour ajouter des articles dans votre panier, entrez une quantité et cliquez sur Ajoutez au panier.

Produit initial

Description Référence VWR Disponibilité Unité Votre prix Prix par Quantité
 

Un nouvel aspect et un engagement renouvelé

Axée sur les fonctionnalités et les ressources que vous connaissez, optimisée avec l’innovation Avantor®. Notre nouvelle marque est synonyme d’agilité et de capacité d’adaptation aux besoins de nos clients.

EN SAVOIR PLUS COMMENCEZ VOS ACHATS