Garder ma session ouverte ?
Fin de session dans  
La session a expirée
Votre session a expiré. Pour votre sécurité, nous vous avons déconnecté.
Voulez-vous vous connecter à nouveau?

Anti-SOS1 Mouse Monoclonal Antibody [clone: 4C1]

Marques : US Biological
Type: Primary
Antigen: SOS1 (son of sevenless homolog 1 (Drosophila))
Clonality: monoclonal
Clone: 4C1
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a Kappa
Reactivity: Human




 

COMMANDE

Développer tout / Réduire tout
Taille Cdt Référence VWR Quantité
100 µg 100 µG USBI133711
Generate Barcodes Barcode Label Format: 
Créer les pages catalogue sous PDF

SPÉCIFICATIONS

Symbole antigène SOS1
Nom de l'antigène son of sevenless homolog 1 (Drosophila)
Réactivité Human
Conjugaison Unconjugated
Clonalité Monoclonal
Type d' Anticorps Primary
Clone 4C1
Hôte Mouse
Isotype IgG2a kappa
ELISA Yes
Amino acid number 313 to 421
Purification purified by Protein A chromatography
Sequence SQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQLEEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIK*
Form liquid
Storage buffer PBS, pH 7,2.
Température de stockage Cool
Shipping temperature Ice

ÉCRIRE UN AVIS

Besoin d'aide ?

  • Précisez ce que vous avez aimé et ce que vous n'avez pas apprécié.
  • Le produit répond-il à vos attentes ?
  • A qui le recommanderiez-vous ?

C'est sous ce nom que VWR va publier votre avis.
Nous recommandons aux auteurs d'utiliser leurs initiales.

Merci de confirmer votre secteur d'activité

Exemple : Recherche Pharmaceutique

Merci de confirmer votre fonction

Exemple : Chercheur

Merci de confirmer votre ville

Exemple : Lille, Clermont

AVIS (0)

Total Evaluation: 0
Moyenne des Notes : 0.0 sur 5

Classer par:

Entrer les détails pour la recherche

Sélectionner les article pour lesquels vous recherchez le certificat

Indiquer le N° de lot. Ce champs est obligatoire. Entrer un "X" si inconnu pour les PC.

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Ou
Editer et comparer les propositions
Nous avons trouvé des articles alternatifs qui vous permettraient d économiser jusque par emballage :   Pour comparer selectionnez jusqu à 3 propositions ci-dessous et cliquer sur comparer. Pour ajouter des articles dans votre panier, entrez une quantité et cliquez sur Ajoutez au panier.

Produit initial

Description Référence VWR Disponibilité Unité Votre prix Prix par Quantité
 

A new look and a renewed commitment

Built on the features & resources you know, optimized with innovation from Avantor®. Our new brand symbolizes agility and our ability to adapt to customer needs.

Learn More Start Shopping