Garder ma session ouverte ?
Fin de session dans  
La session a expirée
Votre session a expiré. Pour votre sécurité, nous vous avons déconnecté.
Voulez-vous vous connecter à nouveau?

Anti-Bhlha9 Rabbit Polyclonal Antibody

Marques : OriGene
Type: Primary
Antigen: Bhlha9
Clonality: Polyclonal
Conjugation: Unconjugated
Host: Rabbit
Isotype: IgG
Reactivity: Mouse



Développer tout / Réduire tout
Taille Cdt Référence VWR Quantité
50 μg 50 µG ORIGTA329615
Générer des codes à barres Format d'étiquette de code à barres: 
Créer les pages catalogue sous PDF


Symbole antigène BHLHA9
Réactivité Mouse
Conjugaison Unconjugated
Clonalité Polyclonal
Type d' Anticorps Primary
Hôte Rabbit
Isotype IgG
Western blot Yes
Cross adsorption No
Immunogen The immunogen for anti-A830053O21Rik antibody: synthetic peptide directed towards the middle region of mouse A830053O21Rik. Synthetic peptide located within the following region: RKRERPTRSKARRMAANVRERKRILDYNEAFNALRRALQHDLGGKRLSKI
Molecular weight 18 kDa
Form Liquid
Storage buffer Lyophilized powder. Add 50 ul of distilled water. Final anti-A830053O21Rik antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Température de stockage – 20 °C
Shipping temperature –20 °C


Besoin d'aide ?

  • Précisez ce que vous avez aimé et ce que vous n'avez pas apprécié.
  • Le produit répond-il à vos attentes ?
  • A qui le recommanderiez-vous ?

C'est sous ce nom que VWR va publier votre avis.
Nous recommandons aux auteurs d'utiliser leurs initiales.

Merci de confirmer votre secteur d'activité

Exemple : Recherche Pharmaceutique

Merci de confirmer votre fonction

Exemple : Chercheur

Merci de confirmer votre ville

Exemple : Lille, Clermont

AVIS (0)

Total Evaluation: 0
Moyenne des Notes : 0.0 sur 5

Classer par:

Entrer les détails pour la recherche

Sélectionner les article pour lesquels vous recherchez le certificat

Indiquer le N° de lot. Ce champs est obligatoire. Entrer un "X" si inconnu pour les PC.

Entrer les détails du certificat

Entrez le numéro de lot:

Choisissez parmi les numéros de lot / lot récents:

Editer et comparer les propositions
Nous avons trouvé des articles alternatifs qui vous permettraient d économiser jusque par emballage :   Pour comparer selectionnez jusqu à 3 propositions ci-dessous et cliquer sur comparer. Pour ajouter des articles dans votre panier, entrez une quantité et cliquez sur Ajoutez au panier.

Produit initial

Description Référence VWR Disponibilité Unité Votre prix Prix par Quantité

Conditions Générales de Vente - version du 30/03/2018

Toutes nos ventes sont soumises aux conditions générales de vente ci-dessous qui sont également  reproduites sur notre catalogue et sur notre site Internet :



Les produits que VWR International fournit doivent être utilisés, sous la seule responsabilité de l’utilisateur qui est un professionnel, conformément à la documentation et aux spécifications du fabricant. VWR International n’est normalement pas habilité à vendre certains produits (principe actif pharmaceutique) car il n’est pas en mesure de se conformer aux exigences de la réglementation applicable (bonnes pratiques de fabrication). Sauf exceptions très limitées, nos produits ne peuvent pas être utilisés en tant que principe actif pharmaceutique en médecine humaine ou vétérinaire. Pour un usage pharmaceutique, cosmétique, en tant que pesticide ou additif alimentaire comme pour les dispositifs médicaux, le Client doit contacter l'organisation commerciale de VWR. Les Clients qui décident d’utiliser nos produits pour les usages cités ci-dessus ou tout autre usage non prévu doivent mener leurs propres vérifications et contrôles afin de s’assurer qu’ils agissent en conformité avec les lois et les réglementations applicables (par exemple : phamacopée européenne). VWR International ne pourra être tenu responsable si le Client fait un usage non conforme à l’usage attendu du produit et auquel il est destiné. Le Client devra alors supporter personnellement les dommages résultants de l’usage non conforme du produit. Le Client est tenu de respecter toutes les règles applicables en matière de sécurité et de santé, et d’adopter les mesures et les préconisations en vigueur pour le stockage, le transport, la vente et l’usage de ces produits. Pour les dispositifs médicaux (CE/IVD), il appartient au Client s’il revend les produits de respecter sous sa responsabilité les obligations vis-à-vis de la matério et de la réactovigilance, de la tracabilité, de la surveillance post-commercialisation et du rappel produit ainsi que les conditions de stockage (notamment respect des températures).


Change control Management

Pour les produits qu'il distribue, VWR International ne contrôle ni n'informe le Client des changements de spécifications touchant aux Produits.

Néanmoins, un accord de Change control  pourra être mis en place entre VWR International et le Client sous certaines conditions et pour certains Produits.


Informations et spécifications

Les informations et spécifications contenues dans les catalogues VWR International ne sont données qu’à titre indicatif et sans engagement. VWR International se réserve le droit de modifier ou de supprimer des produits des catalogues à tout moment et sans préavis.



Sauf stipulation écrite contraire, les prix exprimés en euros (€) s'entendent hors taxes et hors charges sur la base des tarifs en vigueur à la date de validation de la commande.

Une somme forfaitaire pour frais de gestion sera facturée au Client en dessous d'un certain montant de commande, en plus des frais de port applicables à la commande.

VWR International se réserve le droit de modifier, sans préavis et à tout moment, le prix des produits en fonction par exemple des augmentations tarifaires des fournisseurs, des variations de prix des matières premières ou des taux de change des devises étrangères. Pour certains produits, comme par exemple les métaux précieux, les prix ne sont donnés qu'à titre indicatif et seront facturés au cours du jour de la livraison.


VWR International ne fait pas apparaître ses prix publics sur son site Internet. Afin de pouvoir consulter les tarifs applicables, chaque Client est invité à se connecter via son profil personnalisé ou à contacter VWR International pour obtenir une offre de prix.

Les prix sont garantis pour la durée de validité de l'offre ou du devis, exception faite des métaux précieux, de la variation du prix des matières premières, des taux de change des devises étrangères, des droits de douanes etc.

VWR International peut facturer au Client une somme forfaitaire liée à la hausse des cours du pétrole.

Les prix s'entendent pour une marchandise livrée en rez-de-chaussée, non déballée et non installée. Toute prestation complémentaire liée à l’installation fera l’objet d’un supplément tarifaire.


Modalités de paiement

Sauf stipulation écrite contraire, les règlements sont effectués à 30 jours date de facture, net et sans escompte. Toute détérioration du crédit du Client pourra justifier l'exigence de garanties, d'un règlement comptant ou le versement d’un acompte avant l'exécution des commandes.

Le règlement de toute livraison partielle devient normalement exigible à l'échéance portée sur la facture correspondante, et non pas lors de la livraison du solde. 

En cas de retard de paiement par rapport à la date mentionnée sur la facture, VWR International pourra suspendre toute commande en cours, sans préjudice de toute autre voie d'action, et réclamer des pénalités de retard au taux directeur semestriel de la BCE en vigueur au 1er janvier ou au 1er juillet + 10 points exigibles de plein droit le jour suivant la date de règlement ainsi qu’une indemnité forfaitaire pour frais de recouvrement.


Transfert des risques

Le transfert des risques a lieu dès la livraison. Sauf stipulation écrite contraire, la livraison est réputée effectuée au départ des magasins de VWR International.


Clause de réserve de propriété

VWR International ou les ayants droit de VWR International se réservent la propriété des marchandises livrées au Client, jusqu'au paiement intégral du prix en principal, intérêts et accessoires.

En cas de facture non payée à l'échéance, VWR International pourra, sans préjudice d'une action en dommages et intérêts, résilier la vente et reprendre en totalité les marchandises précitées. Cette disposition sera valable même au regard des tiers qui voudraient saisir les marchandises livrées par VWR International.

Le Client s'interdit de donner en gage ou de céder à titre de garantie la propriété des marchandises tant qu'il n'en a pas réglé intégralement le prix.

Dans le cas où le Client se trouverait sous le coup d'une procédure collective, ou de tout événement rendant impossible le paiement des marchandises livrées par le vendeur, et qu'une partie ou la totalité des marchandises aura été vendue par le Client à un sous-acquéreur sans que le sous-acquéreur se soit libéré du prix de la vente vis-à-vis du Client, le Client s'engage à fournir sans délai à VWR International tous renseignements nécessaires à la revendication éventuelle des marchandises par VWR International, sur la créance du prix encore dû par le sous-acquéreur.



Les commandes ne sont définitives que lorsqu'elles sont confirmées par VWR International. En cas d’annulation de commande de la part du Client, des frais pourront lui être facturés. Certaines commandes ne sont pas annulables (hors catalogue).

VWR International recommande d'utiliser les numéros et désignations des catalogues ou des offres VWR International. En cas de libellé imprécis, si VWR International devait faire un choix, VWR International en décline la responsabilité, les frais de retour pour non-conformité qui en découleront seront à la charge du Client.


Livraison et réception des marchandises

VWR International choisit le mode d'envoi qui lui semble le plus approprié pour son Client.

Les produits énumérés dans l'ADR (règlement international sur le transport de produits dangereux) sont expédiés dans le respect des règles en vigueur.

Pour les produits lourds et encombrants ou nécessitant des conditions particulières de transport et d’emballage (par exemple, transport à température dirigée), une somme forfaitaire est facturée au Client, de même que pour toute livraison expresse. Il appartient au Client de s’assurer du dimensionnement des espaces (escalier, porte, local…) devant recevoir le matériel commandé.

La vente des alcools est soumise à une réglementation  très stricte que le Client doit respecter. La Direction Départementale des Douanes contrôle la vente des alcools éthyliques. À cet effet, préalablement à toute livraison, le Client doit transmettre une copie de l'autorisation d'achat d'alcool fournie par la Direction Départementale des Douanes.

Les délais de livraison figurant sur les documents VWR International (devis, AR de commande…) ne sont donnés qu'à titre indicatif. Aucune pénalité de retard ou dommages et intérêts ne pourra être réclamé en cas de dépassement de ces délais. La livraison ne peut se faire que si le Client est à jour de ses obligations envers VWR International.

Le Client  s’engage au moment de la réception :

-  à vérifier l'état et la quantité des marchandises reçues (nombre de colis reçus par rapport au nombre de colis figurant sur le bon de transport) en procédant au besoin à l'ouverture des colis en présence du transporteur,

-  à formuler en cas d'avarie, de colis endommagés ou  manquants des réserves sur le bon de transport,

-  à aviser et transmettre ses réserves au transporteur par lettre recommandée avec accusé de réception dans un délai de 72 heures à compter de la réception conformément à l’article L133-3 du Code de Commerce.

Indépendamment des dispositions à prendre vis-à-vis du transporteur, les réclamations sur les vices apparents doivent être formulées par écrit dans les 10 jours ouvrés de l'arrivée des marchandises au lieu de livraison. Cette réclamation devra mentionner les références figurant sur la facture et le numéro de lot du produit. À défaut du respect de ces prescriptions, les marchandises seront réputées avoir été acceptées par le Client.


Retour des marchandises

Aucun retour ne sera accepté sans accord préalable et écrit de VWR International qui en précisera les modalités. Dans ce cas, les produits seront retournés, dans leur emballage d'origine, en port payé, à l'adresse qui sera communiquée au Client.

En cas de retour de matières dangereuses, le Client est tenu de respecter la réglementation en vigueur (ADR, IMDG, IATA ...).

Un forfait pour frais de contrôle et de remise en stock sera facturé au Client. Si le produit réceptionné en retour s’avère invendable, VWR International pourra facturer des frais de destruction au Client.

Les produits non stockés, commandés spécialement ou fabriqués sur mesure pour le Client (ex : out-sourcing, TPP) qui ne font pas partie de l’offre standard VWR International ne seront pas repris.



Les marchandises vendues par VWR International bénéficient, sauf indication contraire, d’une garantie d’une durée de 12 mois à 24 mois à compter :

-   De la réception technique pour les marchandises installées,

-   De la date de livraison pour les marchandises non installées.


La garantie couvre tout vice caché ou vice de conception provenant d’un défaut de matière ou de fabrication affectant les marchandises livrées et les rendant impropres à l’utilisation.

Cette garantie est limitée soit à la réparation des marchandises chez le Client, soit dans les ateliers de VWR International ou du fabricant selon les cas. Si la réparation n’est pas possible, elle est limitée au remplacement des marchandises non conformes ou affectées d’un vice.

Toute garantie est exclue en cas de mauvaise utilisation, négligence ou défaut d’entretien de la part du Client, comme en cas d’usure normale du bien ou de cas de force majeure.

Le remplacement des marchandises ou pièces défectueuses n’aura pas pour effet de prolonger la durée de la garantie ci-dessus fixée. Les pièces détachées sont garanties 3 mois à compter de leur remplacement par une personne agréee par VWR International. Aucune disponibilité des pièces détachées pendant une certaine durée n’est garantie au Client.

En cas de litige, toute action contentieuse devra être exercée dans un délai d’un an maximum à compter de la livraison ou de la réception technique des marchandises en cause.

Maintenance après garantie :  après expiration de la garantie, VWR International pourra proposer au Client un contrat de maintenance adapté à son besoin.



VWR International est tenue d’une obligation de moyens. Sa responsabilité est limitée au prix perçu pour le produit vendu ainsi qu’aux divers frais rendus nécessaires par son remplacement ou sa réparation. VWR International ne pourra être tenue de la réparation d’un préjudice indirect subi par le Client et/ou un tiers.

La responsabilité de VWR International pourra toutefois être engagée, s'il est prouvé que les dommages causés aux tiers, aux biens ou au personnel du Client résultent d'une faute lourde et/ou intentionnelle de VWR International dans la réalisation de la prestation objet des présentes Conditions Générales de Vente.

Le Client assume sa responsabilité civile contractuelle envers VWR International.


Force majeure

Tout événement imprévisible, irrésistible et indépendant de la volonté des parties qui empêche ou réduit les fabrications et/ou les prestations est considéré comme cas de force majeure et décharge VWR International de l'obligation de livrer.


Protection des données

VWR International protège les données personnelles du Client. Le Client a un droit d’accès, de modification, de rectification et de suppression sur les données personnelles qu’il communique à VWR International. Le Client peut exercer ce droit en adressant une demande écrite à VWR International.


Gestion des déchets

Afin de lutter contre la pollution et veiller au respect de la réglementation, VWR international recycle tous ses déchets d’équipements d’ameublement, électriques et électroniques en contribuant financièrement à plusieurs éco-organismes.



Les présentes Conditions Générales de Vente s’appliquent aux ventes en France métropolitaine. Si le Client souhaite exporter les produits, il s’engage à se rapprocher du département export de VWR International. Toute exportation de produit VWR devra se faire dans le respect des règlementations en vigueur (notamment contrôle des exportations et respect des lois anti-corruption) et sous sa propre responsabilité. Les produits que nous commercialisons sont emballés pour les expéditions en France. Il appartient au Client, en cas d’exportation et sous sa responsabilité de s’assurer que le réemballage qu’il effectue est conforme à la réglementation. 

Pour les ventes à l’exportation et dans les DOM-TOM, les prix sont stipulés départ usine. Un minimum de commande est exigé. En dessous de ce montant, un forfait pour frais de traitement sera facturé au Client.


VWR International est soumise à la loi américaine Foreign Corrupt Practices Act de 1977 («US FCPA») ainsi qu’à la loi française visant à lutter contre toute forme de corruption. Le Client s’engage à respecter les lois et réglementations anti-corruption applicables.


Clause attributive de juridiction - Droit applicable

Les présentes Conditions Générales de Vente sont soumises au droit français. 
Les parties rechercheront un accord amiable avant toute action contentieuse. En cas de litige seront seuls compétents les Tribunaux de Créteil, à moins que VWR International ne préfère saisir toute autre juridiction compétente. Cette clause s'applique même en cas de référé, de demande incidente ou de pluralité de défendeurs ou d'appel en garantie, sans que les clauses attributives de juridiction contenues sur les documents des Clients ne puissent mettre obstacle à l'application de la présente clause.


Imprimer ces conditions