Garder ma session ouverte ?
Fin de session dans  
La session a expirée
Votre session a expiré. Pour votre sécurité, nous vous avons déconnecté.
Voulez-vous vous connecter à nouveau?

Anti-FAM127A Mouse Monoclonal Antibody

Fournisseur: Abnova

Mouse monoclonal antibody raised against a full-length recombinant FAM127A.

Type: Primary
Antigen: FAM127A
Clonality: Monoclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype:
Reactivity: Human



Identifiez-vous pour accéder à vos prix, disponibilités des articles et votre panier d'achat en cours de création
  Se souvenir de moi sur cet appareil
 

COMMANDE

Développer tout / Réduire tout
Taille Cdt Référence VWR Quantité
Up to 5 Clones 1 ABNOH00008933-M
Generate Barcodes Barcode Label Format: 
Créer les pages catalogue sous PDF

SPÉCIFICATIONS

Symbole antigène FAM127A
Nom de l'antigène Family with sequence similarity 127, member A
Réactivité Human
Conjugaison Unconjugated
Clonalité Monoclonal
Type d' Anticorps Primary
Hôte Mouse
Western Blot Yes
ELISA Yes
Antigen synonyms MART8C, Mart8, CXX1, Mar8, MAR8C
Amino acid number 1 to 209
Gene ID 8933
Format Liquid
Cross Adsorption No
Immunogen FAM127A (NP_003919.1, 1 a.a. ~ 209 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence MGGGRGLLGRETLGPGGGCSGEGPLCYWPPPGSPPAPSLRASLPLEPPRCPLRSCSLPRSACLCSRNSAPGSCCRPWASLWSEPPPSPSSQPAPPMYIWTLSCAPAASWAPVTHWTDHPLPPLPSPLLPTRLPDDYIILPTDLRCHSHRHPSHPTDRLLLLVIWTHLGGIWAGHSPWTVIQTAGRPPRDLSPSARPISSPPPETSCVLA
Entrer les détails pour la recherche

Sélectionner les article pour lesquels vous recherchez le certificat

Indiquer le N° de lot. Ce champs est obligatoire. Entrer un "X" si inconnu pour les PC.

Enter Certificate Details

Select Product:

Enter the Lot number:

Choose from recent batch/lot numbers:

Ou
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Description Référence VWR Availability Unité Votre prix Price Per Quantité