Garder ma session ouverte ?
Fin de session dans  
La session a expirée
Votre session a expiré. Pour votre sécurité, nous vous avons déconnecté.
Voulez-vous vous connecter à nouveau?

Anti-DHX34 Rabbit Polyclonal Antibody

Marques : Abnova
Rabbit polyclonal antibody raised against partial recombinant Dhx34.

Recommended Dilutions: Western Blot: 1:1000

Type: Primary
Antigen: DHX34
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype:
Reactivity: Mouse




 

COMMANDE

Développer tout / Réduire tout
Taille Cdt Référence VWR Quantité
50 μg 50 µg ABNOPAB15707
Generate Barcodes Barcode Label Format: 
Créer les pages catalogue sous PDF

SPÉCIFICATIONS

Antigen symbol DHX34
Nom de l'antigène DEAH (Asp-Glu-Ala-His) box polypeptide 34
Réactivité Mouse
Conjugaison Unconjugated
Clonalité Polyclonal
Type d' Anticorps Primary
Host Rabbit
Western blot Yes
Antigen synonyms HRH1, 1810012L18Rik, 1200013B07Rik, mKIAA0134, Ddx34
Gene ID 71723
Format Liquid
Cross adsorption No
Immunogen Recombinant GST fusion protein corresponding to 130 mouse Dhx34.
Sequence GPQTITTAPSLPGLFGNSTLSPHPTKGGYAVSDYLTYNCLTSDTDLYSDCLRSFWTCPHCGLHMPFTPLERIAHENTCPEAPGDDPGSEEAAPAPPQKTSALQRPYHCQVCGQDFLFTPTEVLRHRRQHV
Storage buffer PBS (50% glycerol, 0,02% sodium azide)
Température de stockage Store at – 20 °C. Aliquot to avoid repeated freezing and thawing.

ÉCRIRE UN AVIS

Besoin d'aide ?

  • Précisez ce que vous avez aimé et ce que vous n'avez pas apprécié.
  • Le produit répond-il à vos attentes ?
  • A qui le recommanderiez-vous ?

C'est sous ce nom que VWR va publier votre avis.
Nous recommandons aux auteurs d'utiliser leurs initiales.

Merci de confirmer votre secteur d'activité

Exemple : Recherche Pharmaceutique

Merci de confirmer votre fonction

Exemple : Chercheur

Merci de confirmer votre ville

Exemple : Lille, Clermont

AVIS (0)

Total Evaluation: 0
Moyenne des Notes : 0.0 sur 5

Classer par:

Entrer les détails pour la recherche

Sélectionner les article pour lesquels vous recherchez le certificat

Indiquer le N° de lot. Ce champs est obligatoire. Entrer un "X" si inconnu pour les PC.

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Ou
Editer et comparer les propositions
Nous avons trouvé des articles alternatifs qui vous permettraient d économiser jusque par emballage :   Pour comparer selectionnez jusqu à 3 propositions ci-dessous et cliquer sur comparer. Pour ajouter des articles dans votre panier, entrez une quantité et cliquez sur Ajoutez au panier.

Produit initial

Description Référence VWR Disponibilité Unité Votre prix Prix par Quantité